PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr035515.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 401aa    MW: 43453.1 Da    PI: 7.9947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr035515.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-16118163147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v q+G+ +W+ Ia+++  gR++k+c++rw++ 
      Pbr035515.1 118 RGHWRPAEDSKLKELVGQYGPQNWNVIAEHLD-GRSGKSCRLRWFNQ 163
                      899*****************************.***********996 PP

2Myb_DNA-binding582.1e-18170213146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
      Pbr035515.1 170 RGAFSEEEEERLLAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 213
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.707113164IPR017930Myb domain
SMARTSM007172.6E-13117166IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-28117211IPR009057Homeodomain-like
PfamPF002492.4E-15118163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-26119171IPR009057Homeodomain-like
CDDcd001677.66E-13121162No hitNo description
PROSITE profilePS5129427.18165219IPR017930Myb domain
SMARTSM007171.5E-15169217IPR001005SANT/Myb domain
PfamPF002494.8E-15170212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-21172217IPR009057Homeodomain-like
CDDcd001671.39E-7181212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MAFRHLMSDC DGFTRYQDLN FLPPPPVSNQ LSLSNIFGGS TSAMGVVPFS PSSSQQTNKP  60
WSFQALENGG PNISDLGVLS GVDQKRPTPL NLNLVGEEDD DEGRSPAGGR TSAKSCVRGH  120
WRPAEDSKLK ELVGQYGPQN WNVIAEHLDG RSGKSCRLRW FNQLDPRINR GAFSEEEEER  180
LLAAHRLYGN KWAMIARLFP GRTDNAVKNH WHVIMARSRR EQSHVFKRRK PSSPPPSSPL  240
PHVVANFPKN PSTSTESTVS ISTINDDSTQ SASTCTNLSL TPSNKPPPTF FSKFHPFHRP  300
QIIGSPIGSS SSSDGGFNKM IGSNGNGFCE STGPVRGVGA AAAAMKGVDN SGHQSDSENS  360
GDESVTTTRT NRSLSGEDQD LHHEKTTTIH FIDFLGVGTA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-341172173103C-Myb DNA-Binding Domain
1mse_C3e-341172173103C-Myb DNA-Binding Domain
1a5j_A3e-341172176106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008386891.10.0PREDICTED: transcription factor MYB122
TrEMBLM5VQV01e-158M5VQV0_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06320.14e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-65myb domain protein 105